Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for Glen B 61. Glen B Lv 1 11 pts. 8,860
  2. Avatar for versat82 62. versat82 Lv 1 10 pts. 8,854
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 10 pts. 8,851
  4. Avatar for NotJim99 64. NotJim99 Lv 1 9 pts. 8,842
  5. Avatar for Knoblerine 65. Knoblerine Lv 1 9 pts. 8,816
  6. Avatar for johnmitch 66. johnmitch Lv 1 8 pts. 8,806
  7. Avatar for Amphimixus 67. Amphimixus Lv 1 8 pts. 8,792
  8. Avatar for pfirth 68. pfirth Lv 1 8 pts. 8,788
  9. Avatar for navn 69. navn Lv 1 7 pts. 8,775
  10. Avatar for jausmh 70. jausmh Lv 1 7 pts. 8,769

Comments