Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for tomespen 71. tomespen Lv 1 7 pts. 8,749
  2. Avatar for senor pit 72. senor pit Lv 1 6 pts. 8,740
  3. Avatar for fishercat 73. fishercat Lv 1 6 pts. 8,727
  4. Avatar for micheldeweerd 74. micheldeweerd Lv 1 6 pts. 8,719
  5. Avatar for atlas100 75. atlas100 Lv 1 5 pts. 8,709
  6. Avatar for MicElephant 76. MicElephant Lv 1 5 pts. 8,696
  7. Avatar for kyky 77. kyky Lv 1 5 pts. 8,688
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 5 pts. 8,665
  9. Avatar for georg137 79. georg137 Lv 1 4 pts. 8,632
  10. Avatar for andrewxc 80. andrewxc Lv 1 4 pts. 8,622

Comments