Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for tomespen 71. tomespen Lv 1 7 pts. 8,749
  2. Avatar for senor pit 72. senor pit Lv 1 6 pts. 8,740
  3. Avatar for fishercat 73. fishercat Lv 1 6 pts. 8,727
  4. Avatar for micheldeweerd 74. micheldeweerd Lv 1 6 pts. 8,719
  5. Avatar for atlas100 75. atlas100 Lv 1 5 pts. 8,709
  6. Avatar for MicElephant 76. MicElephant Lv 1 5 pts. 8,696
  7. Avatar for kyky 77. kyky Lv 1 5 pts. 8,688
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 5 pts. 8,665
  9. Avatar for georg137 79. georg137 Lv 1 4 pts. 8,632
  10. Avatar for andrewxc 80. andrewxc Lv 1 4 pts. 8,622

Comments