Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for PM/01/2018 11. PM/01/2018 5 pts. 9,710
  2. Avatar for Deleted group 12. Deleted group pts. 9,696
  3. Avatar for BCC 13. BCC 2 pts. 9,682
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 9,614
  5. Avatar for Russian team 15. Russian team 1 pt. 9,577
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,500
  7. Avatar for Deleted group 17. Deleted group pts. 9,405
  8. Avatar for KNBIBS@MIMUW 18. KNBIBS@MIMUW 1 pt. 9,337
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,303
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 9,244

  1. Avatar for Merf 71. Merf Lv 1 7 pts. 9,793
  2. Avatar for guineapig 72. guineapig Lv 1 6 pts. 9,792
  3. Avatar for Vinara 73. Vinara Lv 1 6 pts. 9,789
  4. Avatar for robgee 74. robgee Lv 1 6 pts. 9,773
  5. Avatar for ViJay7019 75. ViJay7019 Lv 1 5 pts. 9,768
  6. Avatar for bblattmann 76. bblattmann Lv 1 5 pts. 9,767
  7. Avatar for Deleted player 77. Deleted player pts. 9,756
  8. Avatar for cobaltteal 78. cobaltteal Lv 1 5 pts. 9,750
  9. Avatar for Graham MF 79. Graham MF Lv 1 4 pts. 9,745
  10. Avatar for dbuske 80. dbuske Lv 1 4 pts. 9,740

Comments