1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Summary

• Created: January 16, 2018
• Expires: January 24, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

• 1. Beta Folders 100 pts. 10,205
• 2. Gargleblasters 80 pts. 10,137
• 3. Anthropic Dreams 63 pts. 10,110
• 4. Go Science 49 pts. 10,094
• 5. HMT heritage 37 pts. 10,037
• 6. Contenders 28 pts. 10,022
• 7. L'Alliance Francophone 21 pts. 9,979
• 8. Void Crushers 15 pts. 9,941
• 9. Marvin's bunch 11 pts. 9,937
• 10. GENE 433 8 pts. 9,816

Top soloists

• 1. LociOiling 100 pts. 10,205
• 2. Enzyme 97 pts. 10,130
• 3. retiredmichael 95 pts. 10,126
• 4. grogar7 92 pts. 10,104
• 5. ZeroLeak7 89 pts. 10,094
• 6. reefyrob 86 pts. 10,088
• 7. Bruno Kestemont 83 pts. 10,083
• 8. jeff101 81 pts. 10,041
• 9. Galaxie 78 pts. 10,039
• 10. O Seki To 76 pts. 10,037