Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,203
  2. Avatar for dbuske 2. dbuske Lv 1 83 pts. 10,155
  3. Avatar for andrewxc 3. andrewxc Lv 1 68 pts. 10,137
  4. Avatar for Blipperman 4. Blipperman Lv 1 55 pts. 10,137
  5. Avatar for actiasluna 5. actiasluna Lv 1 44 pts. 10,135
  6. Avatar for eromana 6. eromana Lv 1 35 pts. 10,135
  7. Avatar for reefyrob 7. reefyrob Lv 1 27 pts. 10,134
  8. Avatar for Galaxie 8. Galaxie Lv 1 21 pts. 10,110
  9. Avatar for grogar7 9. grogar7 Lv 1 16 pts. 10,098
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 12 pts. 10,093

Comments