Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,205
  2. Avatar for Enzyme 2. Enzyme Lv 1 97 pts. 10,130
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 95 pts. 10,126
  4. Avatar for grogar7 4. grogar7 Lv 1 92 pts. 10,104
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 89 pts. 10,094
  6. Avatar for reefyrob 6. reefyrob Lv 1 86 pts. 10,088
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 83 pts. 10,083
  8. Avatar for jeff101 8. jeff101 Lv 1 81 pts. 10,041
  9. Avatar for Galaxie 9. Galaxie Lv 1 78 pts. 10,039
  10. Avatar for O Seki To 10. O Seki To Lv 1 76 pts. 10,037

Comments