Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for Superphosphate 101. Superphosphate Lv 1 1 pt. 9,563
  2. Avatar for pfirth 102. pfirth Lv 1 1 pt. 9,559
  3. Avatar for rabamino12358 103. rabamino12358 Lv 1 1 pt. 9,556
  4. Avatar for fishercat 104. fishercat Lv 1 1 pt. 9,556
  5. Avatar for shacamin 105. shacamin Lv 1 1 pt. 9,555
  6. Avatar for micheldeweerd 106. micheldeweerd Lv 1 1 pt. 9,554
  7. Avatar for senor pit 107. senor pit Lv 1 1 pt. 9,531
  8. Avatar for navn 108. navn Lv 1 1 pt. 9,528
  9. Avatar for rinze 110. rinze Lv 1 1 pt. 9,511

Comments