Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for lamoille 121. lamoille Lv 1 1 pt. 9,434
  2. Avatar for akina 122. akina Lv 1 1 pt. 9,431
  3. Avatar for realparr0 123. realparr0 Lv 1 1 pt. 9,413
  4. Avatar for The_Otterable 124. The_Otterable Lv 1 1 pt. 9,405
  5. Avatar for RainerGewalt 126. RainerGewalt Lv 1 1 pt. 9,394
  6. Avatar for MyNameIsChef 127. MyNameIsChef Lv 1 1 pt. 9,381
  7. Avatar for Anamfija 128. Anamfija Lv 1 1 pt. 9,379
  8. Avatar for gstelle 129. gstelle Lv 1 1 pt. 9,376
  9. Avatar for JonnyT 130. JonnyT Lv 1 1 pt. 9,356

Comments