Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for Dijkgraaf 131. Dijkgraaf Lv 1 1 pt. 9,348
  2. Avatar for momadoc 132. momadoc Lv 1 1 pt. 9,344
  3. Avatar for Addreoran 133. Addreoran Lv 1 1 pt. 9,337
  4. Avatar for demeter900 134. demeter900 Lv 1 1 pt. 9,331
  5. Avatar for kyky 135. kyky Lv 1 1 pt. 9,323
  6. Avatar for MarcoLeVan 136. MarcoLeVan Lv 1 1 pt. 9,322
  7. Avatar for doctaven 137. doctaven Lv 1 1 pt. 9,303
  8. Avatar for buratino 138. buratino Lv 1 1 pt. 9,290
  9. Avatar for s-roommen 139. s-roommen Lv 1 1 pt. 9,286
  10. Avatar for gulsahsimsir 140. gulsahsimsir Lv 1 1 pt. 9,283

Comments