Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338
  1. Avatar for Ciccillo 141. Ciccillo Lv 1 1 pt. 9,244
  2. Avatar for tarinisrikanth 142. tarinisrikanth Lv 1 1 pt. 9,241
  3. Avatar for gay69bay 143. gay69bay Lv 1 1 pt. 9,228
  4. Avatar for bhfreagra 144. bhfreagra Lv 1 1 pt. 9,215
  5. Avatar for Manasvini 145. Manasvini Lv 1 1 pt. 9,150
  6. Avatar for Stanley P. Arable 146. Stanley P. Arable Lv 1 1 pt. 8,954
  7. Avatar for Deleted player 147. Deleted player pts. 8,810
  8. Avatar for BPS_Silvia_D_Orso_2017 148. BPS_Silvia_D_Orso_2017 Lv 1 1 pt. 8,792
  9. Avatar for aspadistra 149. aspadistra Lv 1 1 pt. 8,695
  10. Avatar for lorentrager 150. lorentrager Lv 1 1 pt. 8,672

Comments