Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 9 pts. 10,083
  2. Avatar for toshiue 12. toshiue Lv 1 7 pts. 10,079
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 5 pts. 10,078
  4. Avatar for Hollinas 14. Hollinas Lv 1 4 pts. 10,077
  5. Avatar for Azukay 15. Azukay Lv 1 3 pts. 10,075
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 2 pts. 10,075
  7. Avatar for pauldunn 17. pauldunn Lv 1 1 pt. 10,073
  8. Avatar for jeff101 18. jeff101 Lv 1 1 pt. 10,073
  9. Avatar for gdnskye 19. gdnskye Lv 1 1 pt. 10,059
  10. Avatar for keithv 20. keithv Lv 1 1 pt. 10,057

Comments