Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816

  1. Avatar for Merf 71. Merf Lv 1 7 pts. 9,793
  2. Avatar for guineapig 72. guineapig Lv 1 6 pts. 9,792
  3. Avatar for Vinara 73. Vinara Lv 1 6 pts. 9,789
  4. Avatar for robgee 74. robgee Lv 1 6 pts. 9,773
  5. Avatar for ViJay7019 75. ViJay7019 Lv 1 5 pts. 9,768
  6. Avatar for bblattmann 76. bblattmann Lv 1 5 pts. 9,767
  7. Avatar for Deleted player 77. Deleted player pts. 9,756
  8. Avatar for cobaltteal 78. cobaltteal Lv 1 5 pts. 9,750
  9. Avatar for Graham MF 79. Graham MF Lv 1 4 pts. 9,745
  10. Avatar for dbuske 80. dbuske Lv 1 4 pts. 9,740

Comments