Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for micheldeweerd 111. micheldeweerd Lv 1 1 pt. 8,812
  2. Avatar for multaq 112. multaq Lv 1 1 pt. 8,812
  3. Avatar for emdee314 113. emdee314 Lv 1 1 pt. 8,800
  4. Avatar for senor pit 114. senor pit Lv 1 1 pt. 8,791
  5. Avatar for Mengee 115. Mengee Lv 1 1 pt. 8,787
  6. Avatar for xabxs 116. xabxs Lv 1 1 pt. 8,758
  7. Avatar for rinze 117. rinze Lv 1 1 pt. 8,754
  8. Avatar for adsilvag 118. adsilvag Lv 1 1 pt. 8,748
  9. Avatar for sciencewalker 119. sciencewalker Lv 1 1 pt. 8,745
  10. Avatar for Abudefduf 120. Abudefduf Lv 1 1 pt. 8,738

Comments