Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  2. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  3. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  4. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  5. Avatar for OmHS 16. OmHS 1 pt. 7,544

  1. Avatar for Arne Heessels 121. Arne Heessels Lv 1 1 pt. 8,738
  2. Avatar for Darco4U 122. Darco4U Lv 1 1 pt. 8,732
  3. Avatar for paja22 123. paja22 Lv 1 1 pt. 8,708
  4. Avatar for Knoblerine 124. Knoblerine Lv 1 1 pt. 8,699
  5. Avatar for Poovent 125. Poovent Lv 1 1 pt. 8,695
  6. Avatar for bblattmann 126. bblattmann Lv 1 1 pt. 8,695
  7. Avatar for bzipitidoo 127. bzipitidoo Lv 1 1 pt. 8,689
  8. Avatar for Noodle Soup 128. Noodle Soup Lv 1 1 pt. 8,687
  9. Avatar for momadoc 130. momadoc Lv 1 1 pt. 8,655

Comments