Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for Giantbluefish 141. Giantbluefish Lv 1 1 pt. 8,485
  2. Avatar for alyssa_d 142. alyssa_d Lv 1 1 pt. 8,482
  3. Avatar for DipsyDoodle2016 143. DipsyDoodle2016 Lv 1 1 pt. 8,464
  4. Avatar for ghiggins 144. ghiggins Lv 1 1 pt. 8,435
  5. Avatar for Oxytree112 145. Oxytree112 Lv 1 1 pt. 8,424
  6. Avatar for Blitzghost 146. Blitzghost Lv 1 1 pt. 8,409
  7. Avatar for JohnLucchi 147. JohnLucchi Lv 1 1 pt. 8,319
  8. Avatar for VictorMD 148. VictorMD Lv 1 1 pt. 8,251
  9. Avatar for will.eickman 149. will.eickman Lv 1 1 pt. 8,031
  10. Avatar for RinkoPatateNeko 150. RinkoPatateNeko Lv 1 1 pt. 7,984

Comments