Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for jausmh 31. jausmh Lv 1 37 pts. 9,482
  2. Avatar for robgee 32. robgee Lv 1 36 pts. 9,460
  3. Avatar for eromana 33. eromana Lv 1 35 pts. 9,459
  4. Avatar for georg137 34. georg137 Lv 1 34 pts. 9,432
  5. Avatar for Glen B 35. Glen B Lv 1 32 pts. 9,424
  6. Avatar for Vinara 36. Vinara Lv 1 31 pts. 9,424
  7. Avatar for O Seki To 37. O Seki To Lv 1 30 pts. 9,384
  8. Avatar for bertro 38. bertro Lv 1 29 pts. 9,381
  9. Avatar for cbwest 39. cbwest Lv 1 28 pts. 9,375
  10. Avatar for katling 40. katling Lv 1 27 pts. 9,358

Comments