Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for alcor29 51. alcor29 Lv 1 17 pts. 9,303
  2. Avatar for phi16 52. phi16 Lv 1 16 pts. 9,299
  3. Avatar for Norrjane 53. Norrjane Lv 1 16 pts. 9,277
  4. Avatar for mberna00 54. mberna00 Lv 1 15 pts. 9,275
  5. Avatar for andrewxc 55. andrewxc Lv 1 14 pts. 9,270
  6. Avatar for isaksson 56. isaksson Lv 1 14 pts. 9,267
  7. Avatar for diamonddays 57. diamonddays Lv 1 13 pts. 9,256
  8. Avatar for TastyMunchies 58. TastyMunchies Lv 1 13 pts. 9,251
  9. Avatar for Deleted player 59. Deleted player pts. 9,246
  10. Avatar for Madde 60. Madde Lv 1 12 pts. 9,235

Comments