Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  2. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  3. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  4. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  5. Avatar for OmHS 16. OmHS 1 pt. 7,544

  1. Avatar for Tehnologik1 61. Tehnologik1 Lv 1 11 pts. 9,222
  2. Avatar for ViJay7019 62. ViJay7019 Lv 1 11 pts. 9,219
  3. Avatar for bcre8tvv 63. bcre8tvv Lv 1 10 pts. 9,208
  4. Avatar for johngran 64. johngran Lv 1 10 pts. 9,199
  5. Avatar for Maerlyn138 65. Maerlyn138 Lv 1 9 pts. 9,189
  6. Avatar for weitzen 66. weitzen Lv 1 9 pts. 9,185
  7. Avatar for Azukay 67. Azukay Lv 1 8 pts. 9,181
  8. Avatar for kyky 68. kyky Lv 1 8 pts. 9,179
  9. Avatar for Jim Fraser 69. Jim Fraser Lv 1 8 pts. 9,171
  10. Avatar for Fat Tony 70. Fat Tony Lv 1 7 pts. 9,167

Comments