Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for SaraL 71. SaraL Lv 1 7 pts. 9,165
  2. Avatar for Deleted player 72. Deleted player pts. 9,157
  3. Avatar for fpc 73. fpc Lv 1 6 pts. 9,156
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 6 pts. 9,131
  5. Avatar for sharondipity 75. sharondipity Lv 1 6 pts. 9,127
  6. Avatar for drjr 76. drjr Lv 1 5 pts. 9,124
  7. Avatar for tarimo 77. tarimo Lv 1 5 pts. 9,123
  8. Avatar for Cagdason 78. Cagdason Lv 1 5 pts. 9,119
  9. Avatar for histon 79. histon Lv 1 5 pts. 9,112
  10. Avatar for SWR_DMaster 80. SWR_DMaster Lv 1 4 pts. 9,110

Comments