Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  2. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  3. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  4. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  5. Avatar for OmHS 16. OmHS 1 pt. 7,544

  1. Avatar for tokens 81. tokens Lv 1 4 pts. 9,105
  2. Avatar for cobaltteal 82. cobaltteal Lv 1 4 pts. 9,105
  3. Avatar for mitarcher 83. mitarcher Lv 1 4 pts. 9,102
  4. Avatar for Alistair69 84. Alistair69 Lv 1 4 pts. 9,093
  5. Avatar for Merf 85. Merf Lv 1 3 pts. 9,088
  6. Avatar for Deleted player 87. Deleted player pts. 9,071
  7. Avatar for SKSbell 88. SKSbell Lv 1 3 pts. 9,057
  8. Avatar for atlas100 89. atlas100 Lv 1 3 pts. 9,031
  9. Avatar for Amphimixus 90. Amphimixus Lv 1 3 pts. 9,023

Comments