Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,116
  2. Avatar for reefyrob 2. reefyrob Lv 1 84 pts. 10,113
  3. Avatar for LociOiling 3. LociOiling Lv 1 70 pts. 10,112
  4. Avatar for bertro 4. bertro Lv 1 57 pts. 10,110
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 47 pts. 10,083
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 38 pts. 9,943
  7. Avatar for Hollinas 7. Hollinas Lv 1 30 pts. 9,943
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 24 pts. 9,940
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 19 pts. 9,937
  10. Avatar for toshiue 10. toshiue Lv 1 15 pts. 9,936

Comments