1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Summary

• Created: February 14, 2018
• Expires: February 21, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

• 1. Beta Folders 100 pts. 10,116
• 2. Gargleblasters 65 pts. 9,954
• 3. Go Science 41 pts. 9,944
• 4. Void Crushers 24 pts. 9,932
• 5. Anthropic Dreams 14 pts. 9,927
• 6. Marvin's bunch 7 pts. 9,839
• 7. L'Alliance Francophone 4 pts. 9,823
• 8. Contenders 2 pts. 9,762
• 9. Russian team 1 pt. 9,402
• 10. freefolder 1 pt. 9,048

Top soloists

• 1. LociOiling 100 pts. 10,102
• 2. Enzyme 97 pts. 9,954
• 3. Fat Tony 94 pts. 9,950
• 4. pauldunn 91 pts. 9,944
• 5. Timo van der Laan 88 pts. 9,932
• 6. eusair 85 pts. 9,932
• 7. Deleted player pts. 9,925
• 8. Bruno Kestemont 79 pts. 9,910
• 9. ZeroLeak7 77 pts. 9,909
• 10. gmn 74 pts. 9,897