Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131
  1. Avatar for rinze 101. rinze Lv 1 1 pt. 9,087
  2. Avatar for arcsign 102. arcsign Lv 1 1 pt. 9,087
  3. Avatar for benrh 103. benrh Lv 1 1 pt. 9,085
  4. Avatar for Winnr 104. Winnr Lv 1 1 pt. 9,074
  5. Avatar for abiogenesis 105. abiogenesis Lv 1 1 pt. 9,056
  6. Avatar for Altercomp 106. Altercomp Lv 1 1 pt. 9,048
  7. Avatar for silent gene 107. silent gene Lv 1 1 pt. 9,039
  8. Avatar for senor pit 108. senor pit Lv 1 1 pt. 9,027
  9. Avatar for antibot215 109. antibot215 Lv 1 1 pt. 9,009
  10. Avatar for momadoc 110. momadoc Lv 1 1 pt. 9,002

Comments