Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131

  1. Avatar for Elektron72 111. Elektron72 Lv 1 1 pt. 8,981
  2. Avatar for sciencewalker 112. sciencewalker Lv 1 1 pt. 8,949
  3. Avatar for Ameer 113. Ameer Lv 1 1 pt. 8,947
  4. Avatar for lamoille 114. lamoille Lv 1 1 pt. 8,934
  5. Avatar for alyssa_d 115. alyssa_d Lv 1 1 pt. 8,933
  6. Avatar for Sydefecks 116. Sydefecks Lv 1 1 pt. 8,931
  7. Avatar for Dijkgraaf 117. Dijkgraaf Lv 1 1 pt. 8,923
  8. Avatar for nellasdim 118. nellasdim Lv 1 1 pt. 8,917
  9. Avatar for parsnip 119. parsnip Lv 1 1 pt. 8,914
  10. Avatar for NotJim99 120. NotJim99 Lv 1 1 pt. 8,914

Comments