Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131

  1. Avatar for pvc78 21. pvc78 Lv 1 50 pts. 9,798
  2. Avatar for Deleted player 22. Deleted player pts. 9,793
  3. Avatar for TastyMunchies 23. TastyMunchies Lv 1 46 pts. 9,783
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 45 pts. 9,764
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 43 pts. 9,762
  6. Avatar for caglar 26. caglar Lv 1 41 pts. 9,752
  7. Avatar for phi16 27. phi16 Lv 1 40 pts. 9,746
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 38 pts. 9,736
  9. Avatar for smilingone 29. smilingone Lv 1 37 pts. 9,733
  10. Avatar for jeff101 30. jeff101 Lv 1 35 pts. 9,731

Comments