Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131

  1. Avatar for diamonddays 31. diamonddays Lv 1 34 pts. 9,727
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 32 pts. 9,722
  3. Avatar for jausmh 33. jausmh Lv 1 31 pts. 9,703
  4. Avatar for Flagg65a 34. Flagg65a Lv 1 30 pts. 9,687
  5. Avatar for Norrjane 35. Norrjane Lv 1 29 pts. 9,685
  6. Avatar for jobo0502 36. jobo0502 Lv 1 28 pts. 9,676
  7. Avatar for Vinara 37. Vinara Lv 1 26 pts. 9,672
  8. Avatar for SKSbell 38. SKSbell Lv 1 25 pts. 9,669
  9. Avatar for Sissue 39. Sissue Lv 1 24 pts. 9,668
  10. Avatar for yaoyy 40. yaoyy Lv 1 23 pts. 9,637

Comments