Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,933
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,864
  3. Avatar for Bio-Med Biology 13. Bio-Med Biology 1 pt. 8,131
  1. Avatar for cinnamonkitty 81. cinnamonkitty Lv 1 3 pts. 9,238
  2. Avatar for frostschutz 82. frostschutz Lv 1 3 pts. 9,235
  3. Avatar for Vincera 83. Vincera Lv 1 3 pts. 9,201
  4. Avatar for hada 84. hada Lv 1 2 pts. 9,199
  5. Avatar for hansvandenhof 85. hansvandenhof Lv 1 2 pts. 9,194
  6. Avatar for pandapharmd 86. pandapharmd Lv 1 2 pts. 9,186
  7. Avatar for xabxs 87. xabxs Lv 1 2 pts. 9,184
  8. Avatar for leehaggis 88. leehaggis Lv 1 2 pts. 9,182
  9. Avatar for FishKAA 89. FishKAA Lv 1 2 pts. 9,181
  10. Avatar for rezaefar 90. rezaefar Lv 1 2 pts. 9,171

Comments