1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Summary

• Created: February 14, 2018
• Expires: February 21, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

• 1. Beta Folders 100 pts. 10,116
• 2. Gargleblasters 65 pts. 9,954
• 3. Go Science 41 pts. 9,944
• 4. Void Crushers 24 pts. 9,932
• 5. Anthropic Dreams 14 pts. 9,927
• 6. Marvin's bunch 7 pts. 9,839
• 7. L'Alliance Francophone 4 pts. 9,823
• 8. Contenders 2 pts. 9,762
• 9. Russian team 1 pt. 9,402
• 10. freefolder 1 pt. 9,048

Top evolvers

• 1. smilingone 100 pts. 10,116
• 2. reefyrob 84 pts. 10,113
• 3. LociOiling 70 pts. 10,112
• 4. bertro 57 pts. 10,110
• 5. retiredmichael 47 pts. 10,083
• 6. Skippysk8s 38 pts. 9,943
• 7. Hollinas 30 pts. 9,943
• 8. Bruno Kestemont 24 pts. 9,940
• 9. ZeroLeak7 19 pts. 9,937
• 10. toshiue 15 pts. 9,936