Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for hudashukor 131. hudashukor Lv 1 1 pt. 7,046
  2. Avatar for Bananatee 132. Bananatee Lv 1 1 pt. 7,023
  3. Avatar for 01010011111 133. 01010011111 Lv 1 1 pt. 6,997
  4. Avatar for yaoyy 134. yaoyy Lv 1 1 pt. 6,987
  5. Avatar for alyssajoyh 135. alyssajoyh Lv 1 1 pt. 6,935
  6. Avatar for gabrielcgs 136. gabrielcgs Lv 1 1 pt. 6,897
  7. Avatar for GomToddard 137. GomToddard Lv 1 1 pt. 6,864
  8. Avatar for ghiggins 138. ghiggins Lv 1 1 pt. 6,693
  9. Avatar for kyaya 139. kyaya Lv 1 1 pt. 6,604
  10. Avatar for Anamfija 140. Anamfija Lv 1 1 pt. 6,573

Comments