Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for hudashukor 131. hudashukor Lv 1 1 pt. 7,046
  2. Avatar for Bananatee 132. Bananatee Lv 1 1 pt. 7,023
  3. Avatar for 01010011111 133. 01010011111 Lv 1 1 pt. 6,997
  4. Avatar for yaoyy 134. yaoyy Lv 1 1 pt. 6,987
  5. Avatar for alyssajoyh 135. alyssajoyh Lv 1 1 pt. 6,935
  6. Avatar for gabrielcgs 136. gabrielcgs Lv 1 1 pt. 6,897
  7. Avatar for GomToddard 137. GomToddard Lv 1 1 pt. 6,864
  8. Avatar for ghiggins 138. ghiggins Lv 1 1 pt. 6,693
  9. Avatar for kyaya 139. kyaya Lv 1 1 pt. 6,604
  10. Avatar for Anamfija 140. Anamfija Lv 1 1 pt. 6,573

Comments