Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 7,637
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 7,046
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 0
  1. Avatar for SWR_DMaster 151. SWR_DMaster Lv 1 1 pt. 0
  2. Avatar for hsalis 152. hsalis Lv 1 1 pt. 0
  3. Avatar for puxatudo 153. puxatudo Lv 1 1 pt. 0
  4. Avatar for aspadistra 154. aspadistra Lv 1 1 pt. 0
  5. Avatar for lamoille 155. lamoille Lv 1 1 pt. 0
  6. Avatar for Hollinas 156. Hollinas Lv 1 1 pt. 0
  7. Avatar for rintscet 157. rintscet Lv 1 1 pt. 0
  8. Avatar for Tdubyah 158. Tdubyah Lv 1 1 pt. 0
  9. Avatar for Ameer 159. Ameer Lv 1 1 pt. 0

Comments