Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for SWR_DMaster 151. SWR_DMaster Lv 1 1 pt. 0
  2. Avatar for lamoille 152. lamoille Lv 1 1 pt. 0
  3. Avatar for Hollinas 153. Hollinas Lv 1 1 pt. 0
  4. Avatar for hsalis 154. hsalis Lv 1 1 pt. 0
  5. Avatar for rintscet 155. rintscet Lv 1 1 pt. 0
  6. Avatar for aspadistra 156. aspadistra Lv 1 1 pt. 0
  7. Avatar for Tdubyah 157. Tdubyah Lv 1 1 pt. 0
  8. Avatar for Ameer 158. Ameer Lv 1 1 pt. 0
  9. Avatar for puxatudo 159. puxatudo Lv 1 1 pt. 0

Comments