Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,193
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 10,139
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 10,113
  4. Avatar for bertro 4. bertro Lv 1 91 pts. 10,101
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 88 pts. 10,077
  6. Avatar for reefyrob 6. reefyrob Lv 1 85 pts. 10,073
  7. Avatar for Enzyme 7. Enzyme Lv 1 82 pts. 10,071
  8. Avatar for frood66 8. frood66 Lv 1 79 pts. 10,013
  9. Avatar for Skippysk8s 9. Skippysk8s Lv 1 76 pts. 10,005
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 74 pts. 9,989

Comments