1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Summary

• Created: February 20, 2018
• Expires: February 28, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,202
• 2. Go Science 71 pts. 10,115
• 3. Gargleblasters 49 pts. 10,077
• 4. Marvin's bunch 33 pts. 10,015
• 5. Void Crushers 22 pts. 9,953
• 6. Anthropic Dreams 14 pts. 9,949
• 7. HMT heritage 8 pts. 9,872
• 8. Contenders 5 pts. 9,796
• 9. L'Alliance Francophone 3 pts. 9,795
• 10. Eastern Prehistoric Force 2 pts. 9,603

Top soloists

• 1. LociOiling 100 pts. 10,193
• 2. retiredmichael 97 pts. 10,139
• 3. ZeroLeak7 94 pts. 10,113
• 4. bertro 91 pts. 10,101
• 5. fiendish_ghoul 88 pts. 10,077
• 6. reefyrob 85 pts. 10,073
• 7. Enzyme 82 pts. 10,071
• 8. frood66 79 pts. 10,013
• 9. Skippysk8s 76 pts. 10,005
• 10. dcrwheeler 74 pts. 9,989