Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for silent gene 101. silent gene Lv 1 1 pt. 9,202
  2. Avatar for pfirth 102. pfirth Lv 1 1 pt. 9,202
  3. Avatar for Knoblerine 103. Knoblerine Lv 1 1 pt. 9,189
  4. Avatar for multaq 104. multaq Lv 1 1 pt. 9,162
  5. Avatar for RainerGewalt 105. RainerGewalt Lv 1 1 pt. 9,159
  6. Avatar for rinze 106. rinze Lv 1 1 pt. 9,157
  7. Avatar for sciencewalker 107. sciencewalker Lv 1 1 pt. 9,153
  8. Avatar for bzipitidoo 108. bzipitidoo Lv 1 1 pt. 9,145
  9. Avatar for nellasdim 109. nellasdim Lv 1 1 pt. 9,118
  10. Avatar for Savas 110. Savas Lv 1 1 pt. 9,094

Comments