Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for thephoenix110 111. thephoenix110 Lv 1 1 pt. 9,085
  2. Avatar for Mike Cassidy 112. Mike Cassidy Lv 1 1 pt. 9,078
  3. Avatar for lamoille 113. lamoille Lv 1 1 pt. 9,067
  4. Avatar for Noodle Soup 114. Noodle Soup Lv 1 1 pt. 9,061
  5. Avatar for alyssajoyh 115. alyssajoyh Lv 1 1 pt. 9,052
  6. Avatar for FractalCuber 116. FractalCuber Lv 1 1 pt. 9,050
  7. Avatar for Lumir 117. Lumir Lv 1 1 pt. 9,048
  8. Avatar for Philippe_C 118. Philippe_C Lv 1 1 pt. 9,043
  9. Avatar for Norbika 119. Norbika Lv 1 1 pt. 9,030
  10. Avatar for sktbrd341 120. sktbrd341 Lv 1 1 pt. 9,030

Comments