Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for Bananatee 141. Bananatee Lv 1 1 pt. 8,415
  2. Avatar for mangoe 142. mangoe Lv 1 1 pt. 8,399
  3. Avatar for pandapharmd 143. pandapharmd Lv 1 1 pt. 8,362
  4. Avatar for gmn 144. gmn Lv 1 1 pt. 8,308
  5. Avatar for aisopi14 145. aisopi14 Lv 1 1 pt. 8,258
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 8,213
  7. Avatar for uttkarsh08 147. uttkarsh08 Lv 1 1 pt. 8,167
  8. Avatar for Aurora20 148. Aurora20 Lv 1 1 pt. 8,167
  9. Avatar for Hollinas 149. Hollinas Lv 1 1 pt. 8,167

Comments