Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 33 pts. 9,795
  2. Avatar for phi16 32. phi16 Lv 1 31 pts. 9,792
  3. Avatar for nicobul 33. nicobul Lv 1 30 pts. 9,791
  4. Avatar for SouperGenious 34. SouperGenious Lv 1 29 pts. 9,787
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 28 pts. 9,786
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 26 pts. 9,784
  7. Avatar for Blipperman 37. Blipperman Lv 1 25 pts. 9,774
  8. Avatar for Fat Tony 38. Fat Tony Lv 1 24 pts. 9,772
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 23 pts. 9,748
  10. Avatar for caglar 40. caglar Lv 1 22 pts. 9,741

Comments