Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for georg137 41. georg137 Lv 1 21 pts. 9,735
  2. Avatar for @lison 42. @lison Lv 1 20 pts. 9,735
  3. Avatar for dizzywings 43. dizzywings Lv 1 19 pts. 9,725
  4. Avatar for toshiue 44. toshiue Lv 1 18 pts. 9,722
  5. Avatar for Sissue 45. Sissue Lv 1 18 pts. 9,716
  6. Avatar for tarimo 46. tarimo Lv 1 17 pts. 9,714
  7. Avatar for robgee 47. robgee Lv 1 16 pts. 9,714
  8. Avatar for jobo0502 48. jobo0502 Lv 1 15 pts. 9,712
  9. Avatar for yaoyy 49. yaoyy Lv 1 15 pts. 9,710
  10. Avatar for alwen 50. alwen Lv 1 14 pts. 9,707

Comments