Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for jeff101 11. jeff101 Lv 1 11 pts. 10,111
  2. Avatar for ManVsYard 12. ManVsYard Lv 1 9 pts. 10,077
  3. Avatar for Fat Tony 13. Fat Tony Lv 1 7 pts. 10,075
  4. Avatar for Sissue 14. Sissue Lv 1 5 pts. 10,071
  5. Avatar for Blipperman 15. Blipperman Lv 1 4 pts. 10,071
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 3 pts. 10,069
  7. Avatar for andrewxc 17. andrewxc Lv 1 2 pts. 10,063
  8. Avatar for jausmh 18. jausmh Lv 1 1 pt. 10,015
  9. Avatar for Galaxie 19. Galaxie Lv 1 1 pt. 9,949
  10. Avatar for Maerlyn138 20. Maerlyn138 Lv 1 1 pt. 9,945

Comments