Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for Bananatee 141. Bananatee Lv 1 1 pt. 8,415
  2. Avatar for mangoe 142. mangoe Lv 1 1 pt. 8,399
  3. Avatar for pandapharmd 143. pandapharmd Lv 1 1 pt. 8,362
  4. Avatar for gmn 144. gmn Lv 1 1 pt. 8,308
  5. Avatar for aisopi14 145. aisopi14 Lv 1 1 pt. 8,258
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 8,213
  7. Avatar for uttkarsh08 147. uttkarsh08 Lv 1 1 pt. 8,167
  8. Avatar for Aurora20 148. Aurora20 Lv 1 1 pt. 8,167
  9. Avatar for Hollinas 149. Hollinas Lv 1 1 pt. 8,167

Comments