Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for eusair 11. eusair Lv 1 71 pts. 9,987
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 68 pts. 9,973
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 66 pts. 9,953
  4. Avatar for Deleted player 14. Deleted player pts. 9,942
  5. Avatar for Galaxie 15. Galaxie Lv 1 61 pts. 9,921
  6. Avatar for jausmh 16. jausmh Lv 1 59 pts. 9,900
  7. Avatar for jeff101 17. jeff101 Lv 1 57 pts. 9,897
  8. Avatar for pauldunn 18. pauldunn Lv 1 55 pts. 9,888
  9. Avatar for mberna00 19. mberna00 Lv 1 53 pts. 9,876
  10. Avatar for O Seki To 20. O Seki To Lv 1 51 pts. 9,872

Comments