Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 33 pts. 9,795
  2. Avatar for phi16 32. phi16 Lv 1 31 pts. 9,792
  3. Avatar for nicobul 33. nicobul Lv 1 30 pts. 9,791
  4. Avatar for SouperGenious 34. SouperGenious Lv 1 29 pts. 9,787
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 28 pts. 9,786
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 26 pts. 9,784
  7. Avatar for Blipperman 37. Blipperman Lv 1 25 pts. 9,774
  8. Avatar for Fat Tony 38. Fat Tony Lv 1 24 pts. 9,772
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 23 pts. 9,748
  10. Avatar for caglar 40. caglar Lv 1 22 pts. 9,741

Comments