Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for georg137 41. georg137 Lv 1 21 pts. 9,735
  2. Avatar for @lison 42. @lison Lv 1 20 pts. 9,735
  3. Avatar for dizzywings 43. dizzywings Lv 1 19 pts. 9,725
  4. Avatar for toshiue 44. toshiue Lv 1 18 pts. 9,722
  5. Avatar for Sissue 45. Sissue Lv 1 18 pts. 9,716
  6. Avatar for tarimo 46. tarimo Lv 1 17 pts. 9,714
  7. Avatar for robgee 47. robgee Lv 1 16 pts. 9,714
  8. Avatar for jobo0502 48. jobo0502 Lv 1 15 pts. 9,712
  9. Avatar for yaoyy 49. yaoyy Lv 1 15 pts. 9,710
  10. Avatar for alwen 50. alwen Lv 1 14 pts. 9,707

Comments