Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795

  1. Avatar for fishercat 71. fishercat Lv 1 5 pts. 9,532
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 4 pts. 9,527
  3. Avatar for Tehnologik1 73. Tehnologik1 Lv 1 4 pts. 9,522
  4. Avatar for dbuske 74. dbuske Lv 1 4 pts. 9,510
  5. Avatar for Jim Fraser 75. Jim Fraser Lv 1 4 pts. 9,504
  6. Avatar for SKSbell 76. SKSbell Lv 1 3 pts. 9,499
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 3 pts. 9,489
  8. Avatar for Psych0Active 78. Psych0Active Lv 1 3 pts. 9,476
  9. Avatar for abiogenesis 79. abiogenesis Lv 1 3 pts. 9,431
  10. Avatar for Merf 80. Merf Lv 1 3 pts. 9,425

Comments