Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 9,472
  2. Avatar for tokens 2. tokens Lv 1 97 pts. 9,378
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 9,326
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 91 pts. 9,296
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 88 pts. 9,287
  6. Avatar for nicobul 6. nicobul Lv 1 85 pts. 9,285
  7. Avatar for LociOiling 7. LociOiling Lv 1 82 pts. 9,254
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 80 pts. 9,247
  9. Avatar for Madde 9. Madde Lv 1 77 pts. 9,221
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 74 pts. 9,216

Comments