Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 9,472
  2. Avatar for tokens 2. tokens Lv 1 97 pts. 9,378
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 9,326
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 91 pts. 9,296
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 88 pts. 9,287
  6. Avatar for nicobul 6. nicobul Lv 1 85 pts. 9,285
  7. Avatar for LociOiling 7. LociOiling Lv 1 82 pts. 9,254
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 80 pts. 9,247
  9. Avatar for Madde 9. Madde Lv 1 77 pts. 9,221
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 74 pts. 9,216

Comments