Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,482
  2. Avatar for phi16 2. phi16 Lv 1 83 pts. 9,452
  3. Avatar for Tehnologik1 3. Tehnologik1 Lv 1 69 pts. 9,451
  4. Avatar for alwen 4. alwen Lv 1 56 pts. 9,451
  5. Avatar for Deleted player 5. Deleted player pts. 9,435
  6. Avatar for lamoille 6. lamoille Lv 1 36 pts. 9,432
  7. Avatar for alcor29 7. alcor29 Lv 1 29 pts. 9,423
  8. Avatar for Hollinas 8. Hollinas Lv 1 23 pts. 9,288
  9. Avatar for toshiue 9. toshiue Lv 1 18 pts. 9,282
  10. Avatar for jeff101 10. jeff101 Lv 1 14 pts. 9,280

Comments