Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 10 pts. 9,280
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 8 pts. 9,280
  3. Avatar for sciencewalker 13. sciencewalker Lv 1 6 pts. 9,255
  4. Avatar for smilingone 14. smilingone Lv 1 4 pts. 9,255
  5. Avatar for LociOiling 15. LociOiling Lv 1 3 pts. 9,251
  6. Avatar for Maerlyn138 16. Maerlyn138 Lv 1 2 pts. 9,232
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 2 pts. 9,222
  8. Avatar for reefyrob 18. reefyrob Lv 1 1 pt. 9,147
  9. Avatar for ViJay7019 19. ViJay7019 Lv 1 1 pt. 9,022
  10. Avatar for ManVsYard 20. ManVsYard Lv 1 1 pt. 8,999

Comments